407.834.2772   E-mail us    Tell a Friend

Shout Outs

“Of all the marketing, advertising and copywriting experts I pay attention to, The Copy Pimp is by far the most articulate and passionate about his work.  The Copy Pimp knows how to ‘climb into the minds’ of his audience through his highly effective writing style. 

It’s amazing how on target you were with the copy you did for my website.  I hired you because of your reputation for writing outstanding copy, and I must say you exceeded my expectations.  I’m a big fan of yours.  Thanks for helping Mr. Prepared become America’s foremost emergency preparation expert.  

From now on when I need good, creative copy – I will call The Copy Pimp.  You are the complete package.  You have helped my marketing hit it’s its target with a bull’s-eye.” 

Thanks again, 

Larry Frank
Alias Mr. Prepared
www.mrprepared.com


As a published author, hiring a copywriter to write on my behalf was a bit uncomfortable- to say the least. Yet Rod’s quick turnaround, writing style, & content blew me away & immediately put my fears at ease.

If you have copywriting needs but little time or know how, I highly recommend that you trust Rod’s experience & let him do what he does best: Drive business to your door through thought provoking, information grabbing, content rich marketing campaigns!

Traci Bild
President
www.TraciBild.com
Author, Speaker, Consultant


I am an entertainment attorney by trade and a nationally known celebrity-branding expert. I have witnessed my fair share of interesting personalities. From Hollywood to Nashville, I’ve been exposed to some amazing talent. In show business, musicians and entertainers must stand out or they often get overlooked.

In business, the success formula is no different. You either stand out in your profession or risk being lumped in with everyone else. Ordinary businesses get ordinary results. The Copy Pimp is no “ordinary” businessman or copywriter. He’s talented and his unique presence demands attention. He is colorful and he is highly effective.

I refer my clients to The Copy Pimp because I know he will deliver outstanding results. As a direct response copywriter, I know his work will hit the bull’s eye. He gets things done on time, and delivers incredible Kennedy-style copy that always pleases both my staff and our clients alike.

Don’t be mislead by the colorful wardrobe. The Copy Pimp is the real deal and at the top of his game when it comes to writing effective Kennedy-style marketing campaigns. For my money, you can’t go wrong trusting your important copywriting projects to the one and only “Copy Pimp.”

Nick Nanton, Esq.
The Celebrity Lawyer
www.CelebrityBrandingYou.com


“I use Rod Harter for all of my copywriting needs. Rod understands the kind of direct response marketing techniques I require for my business.

As a Tax Strategist, my niche market is the affluent, representing the top 1% of taxpayers. It’s important our marketing message be clearly stated whenever we communicate with our customers. Our audience does not have the time or patience for wordy gibberish. It’s all about straightforward communication and marketing.

Rod’s delivery is always on the mark.

Rod Harter’s marketing techniques helped us increase our business almost 400% in one year! Needless to say, I highly recommend Rod’s copywriting talent to anyone serious about their marketing, ready to take their business to the next level.”
Bob J. Baker, CEO
Asset Strategist, Inc.
4767 New Broad Street
Orlando, FL 32814
www.AssetStrategiesOonline.com


As a small business owner, and copywriter, I can appreciate the unique marketing style of The Copy Pimp. He’s not only good, but he is uniquely different. It’s important to have both of attributes in today’s marketplace.

The Copy Pimp is creative and has a keen sense of what it takes to write effective “Kennedy” style marketing campaigns. It boils down to getting results. He knows the formula; right message right audience via the right medium. There are no trophies in our business for being close. You either hit your mark or starve.

The Copy Pimp understands the secret to writing compelling marketing campaigns. He’s a savvy direct response copywriter. That’s why creative entrepreneurs use The Copy Pimp for their marketing campaigns. They know the value of measuring marketing success through their return on investment (ROI). Nothing else counts. Period.

I highly recommend The Copy Pimp to all small business owners looking to separate their business from the pack. Use him once and you won’t work with anyone else.

Nigel Worrall - CEO
Florida Leisure Vacation Homes
4924 W. Irlo Bronson Memorial Highway
Kissimmee, FLFL 34746
T: 407 870 1600
www.floridaleisure.com


“Great copywriters are proven because consumers vote with their money. That’s why people like Rod Harter are so rare and so valuable. Effective marketing is an absolute necessity if you are going to grow a successful business in today’s highly competitive marketplace.

If you enter the marketing jungle in search of riches and respect, just be sure you walk with this man at your side. I used Rod to write the copy and marketing sequence for my $1,000,000.00 mastermind/coaching group series. He has done an outstanding job for me and my company.

I highly recommend Rod to any business owner looking to take a quantum
leap over their competition.”

Brian Fricke, CFP & President
Financial Management Concepts
Winter Springs, FL
www.brianfricke.com


“Rod, as a business owner and fellow copywriter, I have great respect for your highly effective style of writing. After all, I use your services myself (and gladly) pay you for your work when I could do it myself. You certainly do produce some powerful results for your clients.

I’m finding a ton of value and talent in the work you have done for others. You are very good at creating effective “purchase triggers” and emotional buy-buttons in the copy you write for your clients.

It’s a strong testament when one copywriter and business owner uses the services of another. I admire the quality of your work and the effectiveness of your marketing copy. I highly recommend your services to any small business owner or entrepreneur looking to take a quantum leap in their sales and marketing efforts. Keep it up my friend!”

Christopher G. Hurn,
President/CEO/Cofounder
Mercantile Commercial Capital, LLC
940 Centre Circle, Suite 3006
Altamonte Springs, FL 32714
407-786-5040 (O) or 1-866-622-4504
Visit us at: www.504Experts.com


“I am a student of direct response copywriting – if you’re lucky – you run into a few great teachers and mentors along the way. Rod Harter hits the mark with his copywriting talent and expressive style. Whether you’re a novice or seasoned pro, the information and guidance that Rod shares on copywriting and marketing is not just invaluable, but extraordinarily generous.

Best of all, Rod teaches in a way that puts everyone on par. He is amazingly gracious, positive and supportive.”

Peter Kici - Owner
Premier Family Financial Services, LLC
430 Semoran, Suite 206
Casselberry, Fl 32707
pkici@premierfamilyfinancialservices.com
(407) 331-8877


The Copy Pimp has done an outstanding job for us on several of our marketing campaigns. He is easy to work with and his copy always gets the job done and helps us accomplish our objectives. It is a pleasure working with Rod. He goes above and beyond and always exceeds our expectations.

The Copy Pimp does things other copywriters do not know how to do. He knows all the emotional purchase triggers and emotional buy buttons that makes copywriting so valuable to a company. He certainly knows how to get the best response from our campaigns.

I highly recommend Rod Harter, alias “The Copy Pimp” to any entrepreneur or small business owner looking to put some “fire” in their marketing efforts, especially if you are a fan of Dan Kennedy’s style marketing and direct response copy.

Danny Peterson – Owner
Integrity Windows, Siding, Roofing and Doors
2400 Kemp Way • Bowie MD 20715
PHONE: (410) 721-9577 or (301) 499-1076
www.IntegrityWindowsAndSiding.com


Rod Harter does an outstanding job for us. We’ve utilized Rod’s copywriting services for several of our marketing campaigns. He creates a lot of value for us.

There are many writers out there, but very few with a keen sense of Dan Kennedy’s marketing techniques. Our industry is very competitive. The old way of marketing to new prospects is not as effective as direct response mailing. We are doing things this year we have never done before and it’s paying off for us.

You never want to do what the other guys do or the customer will lump you all together. Good marketing is the ability to stand out and get attention with the results that put money in your till. Rod is always on the mark with impressive results. I urge you to give your business to him, at least once, and then you will understand why we don’t use anyone else.

Scott Young- Owner
Advanced Home Technologies
Corporate Office:
71 S. Main Street
Clintonville, WI 54929
1-800-387-9450
info@ahtwindows.com